(data stored in ACNUC7421 zone)

EMBL: AP009493.PE655

AP009493.PE655       Location/Qualifiers
FT   CDS             773299..774309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_655"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_655"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17484"
FT                   /db_xref="GOA:B1VRR6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRR6"
FT                   /protein_id="BAG17484.1"
FT                   /translation="MTSPPTRPAIRAEGLTKRFGKKQALNGVDLEAAPGTVLGVLGPNG
FT                   AGKTTAVRVLSTLLRPDGGRAWMAGHDVLAAPEAVRRDLGLSGQYAAVDEKLSGRENLY
FT                   LVARLYGFGRHAARRRAGQLLSDFDLEDAADLPSKTYSGGMRRRLDLAGALVARPPVVV
FT                   LDEPTTGLDPRGRADTWQAVRSLVAEGTTVLLTTQYLEEADQLADAIVVIESGTVVARG
FT                   SAAQLKARVGGERLSLTVAEPRHRSTATEILATLGEHLPDLDQRTGRLTVATDHGARSL
FT                   EYALSRLRLAGIVVQDVGLAPPTLDDVFLSLTGRPIAPDGATASPGVAVVGGGAR"
     MTSPPTRPAI RAEGLTKRFG KKQALNGVDL EAAPGTVLGV LGPNGAGKTT AVRVLSTLLR        60
     PDGGRAWMAG HDVLAAPEAV RRDLGLSGQY AAVDEKLSGR ENLYLVARLY GFGRHAARRR       120
     AGQLLSDFDL EDAADLPSKT YSGGMRRRLD LAGALVARPP VVVLDEPTTG LDPRGRADTW       180
     QAVRSLVAEG TTVLLTTQYL EEADQLADAI VVIESGTVVA RGSAAQLKAR VGGERLSLTV       240
     AEPRHRSTAT EILATLGEHL PDLDQRTGRL TVATDHGARS LEYALSRLRL AGIVVQDVGL       300
     APPTLDDVFL SLTGRPIAPD GATASPGVAV VGGGAR                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page