(data stored in ACNUC7421 zone)

EMBL: AP009493.PE656

AP009493.PE656       Location/Qualifiers
FT   CDS             774306..775106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_656"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_656"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17485"
FT                   /db_xref="GOA:B1VRR7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRR7"
FT                   /protein_id="BAG17485.1"
FT                   /translation="MTAVQRLGRDSSIIAWRNLLNLRRTPGSVIAALVQPVMFVLLLAY
FT                   VFGGSLGGAEYRTFLMGGIFAQAVTFNSAFTALGLANDMDKGIVDRFRSLPMPAMAVLL
FT                   GRTLSDLTMSAVTLVVTSLCGLLVGWRISASPAEALAAYLLILLFAFAMSWVGAAIGLM
FT                   ARSVEVAQSAGLIWLFPVTFVSAAFVSPHTMPGPLRTVAEWNPVSATATAVRGLFGNPP
FT                   PSGLPTSDAWPVVHALPYSAACAIVITGVFMLLALIRFRRITLG"
     MTAVQRLGRD SSIIAWRNLL NLRRTPGSVI AALVQPVMFV LLLAYVFGGS LGGAEYRTFL        60
     MGGIFAQAVT FNSAFTALGL ANDMDKGIVD RFRSLPMPAM AVLLGRTLSD LTMSAVTLVV       120
     TSLCGLLVGW RISASPAEAL AAYLLILLFA FAMSWVGAAI GLMARSVEVA QSAGLIWLFP       180
     VTFVSAAFVS PHTMPGPLRT VAEWNPVSAT ATAVRGLFGN PPPSGLPTSD AWPVVHALPY       240
     SAACAIVITG VFMLLALIRF RRITLG                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page