(data stored in ACNUC7421 zone)

EMBL: AP009493.PE657

AP009493.PE657       Location/Qualifiers
FT   CDS             complement(775515..776480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_657"
FT                   /product="putative pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_657"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17486"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRR8"
FT                   /protein_id="BAG17486.1"
FT                   /translation="MSNLDRQATPSVCGGRGFVVAEPVRELLAPRRVQLGEGTEVRRLL
FT                   PNLGRRMVGAWAFVDHYGPDDIADEPGMQVPPHPHMGLQTVSWLHEGEVLHRDSLGSLQ
FT                   TVRPRELGLMTSGRAISHSEESPKEHARLLHGAQLWVALPEAHRNIEPHFQHHTDLPVV
FT                   TAPGVTATVILGELDGAASPGTAYTPIVGADMALAGGAEARLPLDPDFEYAVLSMSGEA
FT                   EVDGVPVLPGSMLYLGCGRTELPLRGVSDAGLMLLGGEPFEEELVMFWNFIARSGEEIA
FT                   QARKDWEEGSRFGEVRGYDGARLSAPELPTTPLKPRGRVR"
     MSNLDRQATP SVCGGRGFVV AEPVRELLAP RRVQLGEGTE VRRLLPNLGR RMVGAWAFVD        60
     HYGPDDIADE PGMQVPPHPH MGLQTVSWLH EGEVLHRDSL GSLQTVRPRE LGLMTSGRAI       120
     SHSEESPKEH ARLLHGAQLW VALPEAHRNI EPHFQHHTDL PVVTAPGVTA TVILGELDGA       180
     ASPGTAYTPI VGADMALAGG AEARLPLDPD FEYAVLSMSG EAEVDGVPVL PGSMLYLGCG       240
     RTELPLRGVS DAGLMLLGGE PFEEELVMFW NFIARSGEEI AQARKDWEEG SRFGEVRGYD       300
     GARLSAPELP TTPLKPRGRV R                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page