(data stored in ACNUC7421 zone)

EMBL: AP009493.PE658

AP009493.PE658       Location/Qualifiers
FT   CDS             776630..776995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_658"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_658"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17487"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRR9"
FT                   /protein_id="BAG17487.1"
FT                   /translation="MSETETYYEFGTAADRWDRAQMFFEAKEYLTAARILGGLVGEAPE
FT                   QVAPRLLLARSYYHSARLVKAEQELRVVLELDPVESYAHLMLGRTLERQGRGADAAPHL
FT                   RIAAALTGDFGPGDTGS"
     MSETETYYEF GTAADRWDRA QMFFEAKEYL TAARILGGLV GEAPEQVAPR LLLARSYYHS        60
     ARLVKAEQEL RVVLELDPVE SYAHLMLGRT LERQGRGADA APHLRIAAAL TGDFGPGDTG       120
     S                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page