(data stored in ACNUC7421 zone)

EMBL: AP009493.PE659

AP009493.PE659       Location/Qualifiers
FT   CDS             777108..777770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_659"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_659"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17488"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRS0"
FT                   /protein_id="BAG17488.1"
FT                   /translation="MHGPRSSALGRARSAALIGLAVAVSAGCSGGGDGENREAAERTAR
FT                   PPGTHSWTSRPCDLLAGEAPAEGFTLGSTTDSASPDSQEDIGENGARPLYRQTGCLADL
FT                   KAPDGTFWKLSTRASVYEETEAARRAYRVKQNLDRAHGRGPEKVHDAAYVLSADDQGRP
FT                   GRTLLLWNGDLVLTVSAYAAHGSTEHAVREDLDRIVDNAARRTEDGLRDHGASSPAA"
     MHGPRSSALG RARSAALIGL AVAVSAGCSG GGDGENREAA ERTARPPGTH SWTSRPCDLL        60
     AGEAPAEGFT LGSTTDSASP DSQEDIGENG ARPLYRQTGC LADLKAPDGT FWKLSTRASV       120
     YEETEAARRA YRVKQNLDRA HGRGPEKVHD AAYVLSADDQ GRPGRTLLLW NGDLVLTVSA       180
     YAAHGSTEHA VREDLDRIVD NAARRTEDGL RDHGASSPAA                             220
//

If you have problems or comments...

PBIL Back to PBIL home page