(data stored in ACNUC7421 zone)

EMBL: AP009493.PE66

AP009493.PE66        Location/Qualifiers
FT   CDS             69415..69699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_66t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_66t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16895"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLZ4"
FT                   /protein_id="BAG16895.1"
FT                   /translation="MLRFSVSGPQERFASALTAGAAHGPGVRPVPGAGSAAAEARAEGV
FT                   DAMAAGAGTGVGWEWKALARPESAIVRISRTGIPVACAAPDRASGNGSP"
     MLRFSVSGPQ ERFASALTAG AAHGPGVRPV PGAGSAAAEA RAEGVDAMAA GAGTGVGWEW        60
     KALARPESAI VRISRTGIPV ACAAPDRASG NGSP                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page