(data stored in ACNUC7421 zone)

EMBL: AP009493.PE662

AP009493.PE662       Location/Qualifiers
FT   CDS             complement(779715..780470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_662"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_662"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17491"
FT                   /db_xref="GOA:B1VRS3"
FT                   /db_xref="InterPro:IPR012666"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRS3"
FT                   /protein_id="BAG17491.1"
FT                   /translation="MNSISVRALLVRGMLAGLIAGAFALAVAYFLGESQVDAAIALEEA
FT                   HSHDHGGGEELVSRTMQATGGLATGVLVFGVAVGGIAALVFCYALGRIGGFGPRATAAL
FT                   IAGAALLTVYVVPFLKYPANPPAVGNPDTIGERTALFFLMVALSVLLAVAAVIIGRRLA
FT                   SRLGNWNATVASAAGFILLIGLAYAFLPSFDEVGKDFPAGLLWEFRLSTLAVQVTLWSV
FT                   FGVVFGHLTERLLSPPARVATPRAASAVN"
     MNSISVRALL VRGMLAGLIA GAFALAVAYF LGESQVDAAI ALEEAHSHDH GGGEELVSRT        60
     MQATGGLATG VLVFGVAVGG IAALVFCYAL GRIGGFGPRA TAALIAGAAL LTVYVVPFLK       120
     YPANPPAVGN PDTIGERTAL FFLMVALSVL LAVAAVIIGR RLASRLGNWN ATVASAAGFI       180
     LLIGLAYAFL PSFDEVGKDF PAGLLWEFRL STLAVQVTLW SVFGVVFGHL TERLLSPPAR       240
     VATPRAASAV N                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page