(data stored in ACNUC7421 zone)

EMBL: AP009493.PE663

AP009493.PE663       Location/Qualifiers
FT   CDS             complement(780534..780749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_663"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_663"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17492"
FT                   /db_xref="GOA:B1VRS4"
FT                   /db_xref="InterPro:IPR012667"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRS4"
FT                   /protein_id="BAG17492.1"
FT                   /translation="MAQSAVPATGTSTIAPISAKAIAPWAVFFGILMLVLLYFVGAEQG
FT                   ATAVISGEGVHEWVHDGRHLLGFPCH"
     MAQSAVPATG TSTIAPISAK AIAPWAVFFG ILMLVLLYFV GAEQGATAVI SGEGVHEWVH        60
     DGRHLLGFPC H                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page