(data stored in ACNUC7421 zone)

EMBL: AP009493.PE667

AP009493.PE667       Location/Qualifiers
FT   CDS             complement(783636..785855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_667"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_667"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17496"
FT                   /db_xref="GOA:B1VRS8"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRS8"
FT                   /protein_id="BAG17496.1"
FT                   /translation="MSAEPTGNPFGPTRGPLSPRRSRRAVPVLAFLLAVLCVTTVALTA
FT                   TVRSTVASPGFYQAVLDEESAYDRLYGEVLVDPEISPVTRDLLAHLPVPEALVTSNIKV
FT                   VLPPATVRALTDQQIEAVTGYLRGDRDELRLTVDLAPVLENLADLARVYFGDLVAGIQG
FT                   SDQPDFDRFTADLATALDALKQGRAPNLPTLPLTEDQADRAADALLTTVPERERAALRP
FT                   EIEVALGEGDVSTALAATAAAALSDGSRTAAAGLRTILQGGTWDLTGTLTAAGADVTAL
FT                   ERARDTIRLLTLLQVLALTVALAALATLWFTGPAAPARRLMRLGQALACAGGLTAAAVL
FT                   LARLITGGRLLAVPSSWAPSVAALVDDLQRNAVNQVVATGLSAALTALVGGVLLTGAGW
FT                   ALLVRPGRMPTPTPTAVRTTAAGVACAALAGVLLAPPVFGPSAPRQCLGSSRLCELRYD
FT                   EAAYLTAHNAMSTTADRFIGPLQDPDITTQLDTGVRALQLDTYRWESPQDIAGRLDSPE
FT                   FTPEQRRLITGAIDLANPPREGLWLCHGVCRAGAVELVPALEDIGDWLRSHPTEIVTLI
FT                   VQDDISPEDTEEAFRTAGLEDLLHTPAADPDAPWPTLGEMIDSGRRLVVFAEKADGPAP
FT                   WYRNFYRYGMETPFAFRSPSEMTCEPHRGGTGKQLFLLNHFITNAGGSRLDAGRVNARD
FT                   WVLERTRACEAERGSPVTFIAVDYTTVGDALGAVNELNSTRSERD"
     MSAEPTGNPF GPTRGPLSPR RSRRAVPVLA FLLAVLCVTT VALTATVRST VASPGFYQAV        60
     LDEESAYDRL YGEVLVDPEI SPVTRDLLAH LPVPEALVTS NIKVVLPPAT VRALTDQQIE       120
     AVTGYLRGDR DELRLTVDLA PVLENLADLA RVYFGDLVAG IQGSDQPDFD RFTADLATAL       180
     DALKQGRAPN LPTLPLTEDQ ADRAADALLT TVPERERAAL RPEIEVALGE GDVSTALAAT       240
     AAAALSDGSR TAAAGLRTIL QGGTWDLTGT LTAAGADVTA LERARDTIRL LTLLQVLALT       300
     VALAALATLW FTGPAAPARR LMRLGQALAC AGGLTAAAVL LARLITGGRL LAVPSSWAPS       360
     VAALVDDLQR NAVNQVVATG LSAALTALVG GVLLTGAGWA LLVRPGRMPT PTPTAVRTTA       420
     AGVACAALAG VLLAPPVFGP SAPRQCLGSS RLCELRYDEA AYLTAHNAMS TTADRFIGPL       480
     QDPDITTQLD TGVRALQLDT YRWESPQDIA GRLDSPEFTP EQRRLITGAI DLANPPREGL       540
     WLCHGVCRAG AVELVPALED IGDWLRSHPT EIVTLIVQDD ISPEDTEEAF RTAGLEDLLH       600
     TPAADPDAPW PTLGEMIDSG RRLVVFAEKA DGPAPWYRNF YRYGMETPFA FRSPSEMTCE       660
     PHRGGTGKQL FLLNHFITNA GGSRLDAGRV NARDWVLERT RACEAERGSP VTFIAVDYTT       720
     VGDALGAVNE LNSTRSERD                                                    739
//

If you have problems or comments...

PBIL Back to PBIL home page