(data stored in ACNUC7421 zone)

EMBL: AP009493.PE67

AP009493.PE67        Location/Qualifiers
FT   CDS             complement(69871..70098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_67t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_67t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16896"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLZ5"
FT                   /protein_id="BAG16896.1"
FT                   /translation="MNNAGGNTDCDSDGATDLAAYTRDFHANLDANLVSAALTTKALDD
FT                   RLAPGGAVVHIGSIAADQGAGSYGAAKLYG"
     MNNAGGNTDC DSDGATDLAA YTRDFHANLD ANLVSAALTT KALDDRLAPG GAVVHIGSIA        60
     ADQGAGSYGA AKLYG                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page