(data stored in ACNUC7421 zone)

EMBL: AP009493.PE671

AP009493.PE671       Location/Qualifiers
FT   CDS             790674..790919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_671"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17500"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRT2"
FT                   /protein_id="BAG17500.1"
FT                   /translation="MRRLIVLPRSNGSVSHPRAPRRHPDRFFPHEGDHVVIATGAEARS
FT                   GRDHGPAITRVRTADGHQPPGTEHFTSMGGRPTGRP"
     MRRLIVLPRS NGSVSHPRAP RRHPDRFFPH EGDHVVIATG AEARSGRDHG PAITRVRTAD        60
     GHQPPGTEHF TSMGGRPTGR P                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page