(data stored in ACNUC7421 zone)

EMBL: AP009493.PE673

AP009493.PE673       Location/Qualifiers
FT   CDS             complement(791859..792830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_673"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_673"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17502"
FT                   /db_xref="GOA:B1VRT4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRT4"
FT                   /protein_id="BAG17502.1"
FT                   /translation="MTSRPNIRTAALTGLAPAVWGSTYLVATELLPPDRPLLATTVRAL
FT                   PGGLVLLALGRRLPAGVWWWRAPVLGVLNIGAFNFLLFLAAYRLPGGIAAVIMSAQPMF
FT                   VVVLAALFLGERIRALHALACVMGAGGVALLVLRGAAPLDALGVLAAVGGALCMGLGIT
FT                   LTKRWGRPEGVGLLTFTGWQLTAGGLVLLPFWLSLEGLPDSLTGSNVLGFAHLITLGAV
FT                   LSYFVWFRGIERLPAVAVSFLALGSPVVATLLGYLVRGETLSVLQLVGMAVILGAVVLG
FT                   QRPPPVPAAGPEPARRNLHEPHPARSGETVREGGRPGGRTRP"
     MTSRPNIRTA ALTGLAPAVW GSTYLVATEL LPPDRPLLAT TVRALPGGLV LLALGRRLPA        60
     GVWWWRAPVL GVLNIGAFNF LLFLAAYRLP GGIAAVIMSA QPMFVVVLAA LFLGERIRAL       120
     HALACVMGAG GVALLVLRGA APLDALGVLA AVGGALCMGL GITLTKRWGR PEGVGLLTFT       180
     GWQLTAGGLV LLPFWLSLEG LPDSLTGSNV LGFAHLITLG AVLSYFVWFR GIERLPAVAV       240
     SFLALGSPVV ATLLGYLVRG ETLSVLQLVG MAVILGAVVL GQRPPPVPAA GPEPARRNLH       300
     EPHPARSGET VREGGRPGGR TRP                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page