(data stored in ACNUC7421 zone)

EMBL: AP009493.PE677

AP009493.PE677       Location/Qualifiers
FT   CDS             795586..797802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_677"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17506"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRT8"
FT                   /protein_id="BAG17506.1"
FT                   /translation="MGWFSRRSAPGSHTALLRTSDSRAAGGAVLLSTRRILTCAHVVND
FT                   ALGRALLSTEHPEHGGAFAVSFRGADAAAGVGTGRVSLWLPPQQRAGSPVWGGDLAVLD
FT                   LDEPAPDWTRPVVWQDMLEGMELRAWHGGGAAITYANTVAGLQHDGCCYLDGSLSGAAI
FT                   GPGYSGGPLWVRSDATVAGLAVAQVMSDGPALKAQDTVRRGWAVPWQTIREEMTRAGAG
FT                   DVVAECQVVRRGRATGPAETSVQAMAPLLRTLLDDPVRRTDHCRDLSFALECDVPTGGA
FT                   QAPTLDEVATVLLTEDRALATLSESLAPAVEHDPPRRRALSALLALGRVEDHVRLLSFA
FT                   EHRQLVGFLQTSVRTDPGLIARAAREALRFMNLPIVLSQASRPTVADVDAIILDLEDYP
FT                   DGGLTTAQSVPVPALLRLTEFAAAATADTTHRARLRAWCDRVADRLDISPPALAERRAD
FT                   AETWAAHRPSPVTRVGTRLTPADGEPAGRFRCEIWLWHRDGTRVGVTTPKAFLTPEEIG
FT                   RLLRRTAEGSRAAGEPAPTQVDVVVGPAHLEIDVDGWETGSELADGLPELSGLRDVLPD
FT                   VSGLSVALGSRYQVALRCPDFTVRTADEVQRRWAADTPHSLVVGDPSVDIQHLYELLST
FT                   THRDTVRVVLHGPPQQRSRLLPVCLAMGVPVVLWDRAATSHDDAPRLDHLDPTGPLDKL
FT                   PQRLQNLRSAIYGAEAGLSTARPALVWHDTELSLPEPLQFADPA"
     MGWFSRRSAP GSHTALLRTS DSRAAGGAVL LSTRRILTCA HVVNDALGRA LLSTEHPEHG        60
     GAFAVSFRGA DAAAGVGTGR VSLWLPPQQR AGSPVWGGDL AVLDLDEPAP DWTRPVVWQD       120
     MLEGMELRAW HGGGAAITYA NTVAGLQHDG CCYLDGSLSG AAIGPGYSGG PLWVRSDATV       180
     AGLAVAQVMS DGPALKAQDT VRRGWAVPWQ TIREEMTRAG AGDVVAECQV VRRGRATGPA       240
     ETSVQAMAPL LRTLLDDPVR RTDHCRDLSF ALECDVPTGG AQAPTLDEVA TVLLTEDRAL       300
     ATLSESLAPA VEHDPPRRRA LSALLALGRV EDHVRLLSFA EHRQLVGFLQ TSVRTDPGLI       360
     ARAAREALRF MNLPIVLSQA SRPTVADVDA IILDLEDYPD GGLTTAQSVP VPALLRLTEF       420
     AAAATADTTH RARLRAWCDR VADRLDISPP ALAERRADAE TWAAHRPSPV TRVGTRLTPA       480
     DGEPAGRFRC EIWLWHRDGT RVGVTTPKAF LTPEEIGRLL RRTAEGSRAA GEPAPTQVDV       540
     VVGPAHLEID VDGWETGSEL ADGLPELSGL RDVLPDVSGL SVALGSRYQV ALRCPDFTVR       600
     TADEVQRRWA ADTPHSLVVG DPSVDIQHLY ELLSTTHRDT VRVVLHGPPQ QRSRLLPVCL       660
     AMGVPVVLWD RAATSHDDAP RLDHLDPTGP LDKLPQRLQN LRSAIYGAEA GLSTARPALV       720
     WHDTELSLPE PLQFADPA                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page