(data stored in ACNUC7421 zone)

EMBL: AP009493.PE678

AP009493.PE678       Location/Qualifiers
FT   CDS             797876..798895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_678"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_678"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17507"
FT                   /db_xref="GOA:B1VRT9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRT9"
FT                   /protein_id="BAG17507.1"
FT                   /translation="MTAQAPQGHHGAADSRQDSDWRLFKGNGRARQVSFPEAPPWRRFG
FT                   DKEARSRRTRPYLIGPQEADVVNAALLLRRPLLVTGHPGTGKSSLAHALAHELSLGHVL
FT                   HWPVNSRTTLQDALYRYDAIGRLRETNRRRNARDDENAPQEDPGIGSYVRLGPLGTALV
FT                   PSASPRVLLVDELDKGDVDLPNDLLNVFEEGEFEIPELARLTEEQSAVSVMTADSDVWT
FT                   DVVRGRIRCTEFPVVIITSNGERDFPPAFLRRCVRLDLPEPDEERLRAIISAHLDPDGE
FT                   EGGTDGFDDLMRAFLARRARGELATDQLLNAVFLRRGGVELDAEGLLDAVLHRLGRTL"
     MTAQAPQGHH GAADSRQDSD WRLFKGNGRA RQVSFPEAPP WRRFGDKEAR SRRTRPYLIG        60
     PQEADVVNAA LLLRRPLLVT GHPGTGKSSL AHALAHELSL GHVLHWPVNS RTTLQDALYR       120
     YDAIGRLRET NRRRNARDDE NAPQEDPGIG SYVRLGPLGT ALVPSASPRV LLVDELDKGD       180
     VDLPNDLLNV FEEGEFEIPE LARLTEEQSA VSVMTADSDV WTDVVRGRIR CTEFPVVIIT       240
     SNGERDFPPA FLRRCVRLDL PEPDEERLRA IISAHLDPDG EEGGTDGFDD LMRAFLARRA       300
     RGELATDQLL NAVFLRRGGV ELDAEGLLDA VLHRLGRTL                              339
//

If you have problems or comments...

PBIL Back to PBIL home page