(data stored in ACNUC7421 zone)

EMBL: AP009493.PE679

AP009493.PE679       Location/Qualifiers
FT   CDS             798892..802104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_679"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_679"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17508"
FT                   /db_xref="GOA:B1VRU0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRU0"
FT                   /protein_id="BAG17508.1"
FT                   /translation="MTGRPELGRIRRALAADGEPLDAEELLDVLWLAARLPPSAATALA
FT                   RAAALAEPPAVDPAHRDADGSTPFAPPSPGHDAPDLATADTEPGPVLRPAGETGLHAAP
FT                   LVRQPPARSDRPAMAVRAPGVKALGGAELRLGRALRPLKQMRPDFLRSELDINATVTAM
FT                   AETGLPEAVLRPATTRWLDLTVLVDDGVSMLLWQGLAGELRRLLERCGAFRQVRVHGLG
FT                   TRGPTGPRLRSRPYGASAATLPLSAVLDPAGNTLLLVVSDGVGRSWRDGSMHEALLRAA
FT                   SAGPTAVVHTLPRRLWAGTGIGARSWRVTARRRGAANRSWHIEDPLLPPELAPFDGVPV
FT                   PVLATDGDVIGTWAQLIGSPGETAVLPLLTPPPGTVTAPPPPGSPRRDRTVGAREAVSR
FT                   FRDSASTDAYRLAAHLASVAPLPVPVMRIVQHAVAPAVDTSHLVEVFLGGLMHSADEVE
FT                   RPPHQRAFDFTEETRQILLGTVPPAELMRTTRRVTAHLSELGGSPADFPAWLPHPGGED
FT                   RVSADSRKPFGWVGETLLRRLGVSPPDVSEYETPLSPDDELRPLPPGPTLALHTTRWRR
FT                   LTVSDQRFEGRWALPYDVFAEYGPVESGVFLAHDGEGRLLVIRRPGDEPDAHALIATEV
FT                   LALQRMNGSCSPLLMAWEPDHERPWHAVLCALDDPTQPAPDLHDFTVQHGLLHHAGLLT
FT                   VARQLATGLARAHELGLVHGALTSGRVLIAGRDAQILGWLTASVDGMDSRYWSVHRQHP
FT                   RYRAPELNDATEGPTREADVYALGCVLVEAAVGQGYHGSPSDALEAAREALEPAFIGIL
FT                   RACLHDDPARRPPALQLRRALDSLAGQETDPFTVALGFDADLDSVRLDLRGEPGGGDGP
FT                   HLLCQGRPAQVRRDLLLGVLEQISRQAGRGVAFVLADFDHRSGFDRFARRPGDVSFLGL
FT                   RQGGTDVLALGDLLRRELRRREAPDARGAYGQDRPPLLVVAMDDFPRVHRLAPELHTVL
FT                   REVARAGGRLDIHLIMSADHMDLVATDNAFVSRCARVDLLSRTAEDGSLALDGAVLHIH
FT                   SEVGPVYFTTGHESAVAADRHR"
     MTGRPELGRI RRALAADGEP LDAEELLDVL WLAARLPPSA ATALARAAAL AEPPAVDPAH        60
     RDADGSTPFA PPSPGHDAPD LATADTEPGP VLRPAGETGL HAAPLVRQPP ARSDRPAMAV       120
     RAPGVKALGG AELRLGRALR PLKQMRPDFL RSELDINATV TAMAETGLPE AVLRPATTRW       180
     LDLTVLVDDG VSMLLWQGLA GELRRLLERC GAFRQVRVHG LGTRGPTGPR LRSRPYGASA       240
     ATLPLSAVLD PAGNTLLLVV SDGVGRSWRD GSMHEALLRA ASAGPTAVVH TLPRRLWAGT       300
     GIGARSWRVT ARRRGAANRS WHIEDPLLPP ELAPFDGVPV PVLATDGDVI GTWAQLIGSP       360
     GETAVLPLLT PPPGTVTAPP PPGSPRRDRT VGAREAVSRF RDSASTDAYR LAAHLASVAP       420
     LPVPVMRIVQ HAVAPAVDTS HLVEVFLGGL MHSADEVERP PHQRAFDFTE ETRQILLGTV       480
     PPAELMRTTR RVTAHLSELG GSPADFPAWL PHPGGEDRVS ADSRKPFGWV GETLLRRLGV       540
     SPPDVSEYET PLSPDDELRP LPPGPTLALH TTRWRRLTVS DQRFEGRWAL PYDVFAEYGP       600
     VESGVFLAHD GEGRLLVIRR PGDEPDAHAL IATEVLALQR MNGSCSPLLM AWEPDHERPW       660
     HAVLCALDDP TQPAPDLHDF TVQHGLLHHA GLLTVARQLA TGLARAHELG LVHGALTSGR       720
     VLIAGRDAQI LGWLTASVDG MDSRYWSVHR QHPRYRAPEL NDATEGPTRE ADVYALGCVL       780
     VEAAVGQGYH GSPSDALEAA REALEPAFIG ILRACLHDDP ARRPPALQLR RALDSLAGQE       840
     TDPFTVALGF DADLDSVRLD LRGEPGGGDG PHLLCQGRPA QVRRDLLLGV LEQISRQAGR       900
     GVAFVLADFD HRSGFDRFAR RPGDVSFLGL RQGGTDVLAL GDLLRRELRR REAPDARGAY       960
     GQDRPPLLVV AMDDFPRVHR LAPELHTVLR EVARAGGRLD IHLIMSADHM DLVATDNAFV      1020
     SRCARVDLLS RTAEDGSLAL DGAVLHIHSE VGPVYFTTGH ESAVAADRHR                 1070
//

If you have problems or comments...

PBIL Back to PBIL home page