(data stored in ACNUC7421 zone)

EMBL: AP009493.PE68

AP009493.PE68        Location/Qualifiers
FT   CDS             complement(70095..70469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_68t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_68t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16897"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLZ6"
FT                   /protein_id="BAG16897.1"
FT                   /translation="MAVDEDQPFQAKEIPRGKEFHGSVPAFSLSVKEQVRHHVTPEQGL
FT                   KGLKLRVTTRLRGATGIGRATVRLFAEQGETVIVTGRRPGPLHELAAESGVRTLVCDHT
FT                   DPRALTSPSCRSCRTGSTSL"
     MAVDEDQPFQ AKEIPRGKEF HGSVPAFSLS VKEQVRHHVT PEQGLKGLKL RVTTRLRGAT        60
     GIGRATVRLF AEQGETVIVT GRRPGPLHEL AAESGVRTLV CDHTDPRALT SPSCRSCRTG       120
     STSL                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page