(data stored in ACNUC7421 zone)

EMBL: AP009493.PE681

AP009493.PE681       Location/Qualifiers
FT   CDS             complement(804324..804971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_681"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17510"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRU2"
FT                   /protein_id="BAG17510.1"
FT                   /translation="MTAADQPSTARADAPGPASFIAAAAALAATDEALRDAQRRSPDAV
FT                   SPGPEQALASLMLLRQVREHLASWETGLIETARGAGASWADLARPLGVASRQAAERRYL
FT                   RGRPGAAGTTGEQRVAATRRARAADRATADWARANAADLRRLSGQIAALAPLAPDARSA
FT                   QDALRAALGAADAAELVAPLAGIRPHLDARHRGLVESLDALDAPGAQPRPWR"
     MTAADQPSTA RADAPGPASF IAAAAALAAT DEALRDAQRR SPDAVSPGPE QALASLMLLR        60
     QVREHLASWE TGLIETARGA GASWADLARP LGVASRQAAE RRYLRGRPGA AGTTGEQRVA       120
     ATRRARAADR ATADWARANA ADLRRLSGQI AALAPLAPDA RSAQDALRAA LGAADAAELV       180
     APLAGIRPHL DARHRGLVES LDALDAPGAQ PRPWR                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page