(data stored in ACNUC7421 zone)

EMBL: AP009493.PE684

AP009493.PE684       Location/Qualifiers
FT   CDS             complement(809259..810578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_684"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_684"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17513"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRU5"
FT                   /protein_id="BAG17513.1"
FT                   /translation="MVAILRCTPGEVKFLDSRKRQEQLDAGWESVGERSEWTSRHVVLV
FT                   VTGQERGRPGVEYVGQARSGRSAGTFRRVVEVTQLHRIVPPVPMEALSDQLPLRHRDAV
FT                   DRSGVLTKRSGEELLNGLTTCRADLAAVIARLQERVGGIRILGRVRALFLEQRDATGLA
FT                   LQLGGFDRSIIEEAEFPEEGGGQIPVLATLPGHPAHEDHLVAHDAQRFSDWIGNDAEYL
FT                   ATRVFRKGDQQLFIANVNRLPAEETLGIDLIYHHVNRDSFILVQYKKMGQVGAGRSEWG
FT                   YRPDGDLDDQLKRMREVEDACTRLEQDPPTDYRFVHQPCWIKFCKSEQVAPKGDALIGG
FT                   MYLTREHVEWLRGRPGLAVGPKGGELFGYHTVPRYLDNTTFTQLVQDGWIGTRGRASDI
FT                   IQAQIKASLDGSRALVFAGLIGDDMTQAERTRERRGGSGS"
     MVAILRCTPG EVKFLDSRKR QEQLDAGWES VGERSEWTSR HVVLVVTGQE RGRPGVEYVG        60
     QARSGRSAGT FRRVVEVTQL HRIVPPVPME ALSDQLPLRH RDAVDRSGVL TKRSGEELLN       120
     GLTTCRADLA AVIARLQERV GGIRILGRVR ALFLEQRDAT GLALQLGGFD RSIIEEAEFP       180
     EEGGGQIPVL ATLPGHPAHE DHLVAHDAQR FSDWIGNDAE YLATRVFRKG DQQLFIANVN       240
     RLPAEETLGI DLIYHHVNRD SFILVQYKKM GQVGAGRSEW GYRPDGDLDD QLKRMREVED       300
     ACTRLEQDPP TDYRFVHQPC WIKFCKSEQV APKGDALIGG MYLTREHVEW LRGRPGLAVG       360
     PKGGELFGYH TVPRYLDNTT FTQLVQDGWI GTRGRASDII QAQIKASLDG SRALVFAGLI       420
     GDDMTQAERT RERRGGSGS                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page