(data stored in ACNUC7421 zone)

EMBL: AP009493.PE686

AP009493.PE686       Location/Qualifiers
FT   CDS             complement(811947..815813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_686"
FT                   /product="hypothetical WD-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_686"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17515"
FT                   /db_xref="GOA:B1VRU7"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033510"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRU7"
FT                   /protein_id="BAG17515.1"
FT                   /translation="MAFPKAESLQRRRVRVREVVAPPVEDQDIDDVAVLILEESVSRNH
FT                   VARLRRPEVGSLVHRRWWAFGFPDGMLGNSSGGEIGEELGYGWVRLDTSARYPIQGGYS
FT                   GAALWSPDYGAVVGMVGQGQGGNGDGRAITLRAIDACLPEQKLHLLADWSAESAGESAM
FT                   AAWGWSLTDDPEAGRHWRPRARGVSTDAERGFRFCGRTAALQKIVSWLVGEEAKRQILV
FT                   VTGSPGVGKSAVLGRIVTTADVSLSASLPPDESVRAPEGSVACAVHAKSKSALEVAEEI
FT                   ARAASANLPARVSDLAPHIRDALESGGRTGFTVVIDALDEAASPDEARLILRRVAQPLA
FT                   ENLEDLGVRVVVGSRRSDDAGSLFDEFGLSTNILDLDNPEFFDFADLATYALATLQLRG
FT                   AERRDNPYNDVALAAPVADRIAQLSEGNFLVAGLIARAHGMYDHQPVGPERLTFPPTVD
FT                   AALHEYLDLLPDVDGVPANAVLTALAYAEAPGMPLDLWRVTISALGHAVPSEKHLLAFA
FT                   RSSAANFLVETSTSDPQNAVFRLFHQALNDALVRQRSAVRDEGAIASALLQHGQSVGWS
FT                   EAPAYLLRALPRHAERGRSVDQLLSDPTFALYADLRRLIPAATSASSPHARRQARLLRR
FT                   TLRALDASPSDRAALLSVTETLDNLGNTYSTSAHPAPYRARWAAAVPHEEEAILEGHRD
FT                   WVRTVCSVEAAGRQLLATASDDATVRLWDPETGELVRVLEGHSDYVLTVRTVATEQGKL
FT                   LLTTSADGTARVWDPNQGETVRRFDGIGDWVRSACIGRMAGRTVLATASDDRVVRFWNM
FT                   DTGREIRTVKAHHRHRIRAVCALGEVFAAAGDDGLIRLLDPRGGESIVLRGHGGSVNAL
FT                   CAFFLDERAMLATASADGTARVWDLESASQHVVLKGHREELNAVHAFSLEGRTVLATAS
FT                   DDGTARLWDPKTGNQLAVFNGHVDWVLDVCSLPLGGRTQLATAGSDGTVRLWNPNREQH
FT                   AGLRGSTSVGAACALPLEAGTALATASNNGAVSLVNPETGEQLRTIKGSHGWDSCVCAV
FT                   PVKGRTLLATSSTDRSARVWDPETSRQVRVLKGHGSRVKSMCILTSKGRTLLATGSADA
FT                   TARLWNPENGKQLRVLKGHTGWVLTMCVIPMDDRSVLATGSADGTARLWDPESGRQLHM
FT                   VKDPSGRVQSMCAVDVGGRAVLAAAGRGTIGLWNPANGEQLRILESNSEVRSMCAIGVN
FT                   GRSLLAVASDDRTVRLWDPANGQTVAEIPVGAAGRVVIEAGGLLLVSTWRGILALDLAS
FT                   RGLF"
     MAFPKAESLQ RRRVRVREVV APPVEDQDID DVAVLILEES VSRNHVARLR RPEVGSLVHR        60
     RWWAFGFPDG MLGNSSGGEI GEELGYGWVR LDTSARYPIQ GGYSGAALWS PDYGAVVGMV       120
     GQGQGGNGDG RAITLRAIDA CLPEQKLHLL ADWSAESAGE SAMAAWGWSL TDDPEAGRHW       180
     RPRARGVSTD AERGFRFCGR TAALQKIVSW LVGEEAKRQI LVVTGSPGVG KSAVLGRIVT       240
     TADVSLSASL PPDESVRAPE GSVACAVHAK SKSALEVAEE IARAASANLP ARVSDLAPHI       300
     RDALESGGRT GFTVVIDALD EAASPDEARL ILRRVAQPLA ENLEDLGVRV VVGSRRSDDA       360
     GSLFDEFGLS TNILDLDNPE FFDFADLATY ALATLQLRGA ERRDNPYNDV ALAAPVADRI       420
     AQLSEGNFLV AGLIARAHGM YDHQPVGPER LTFPPTVDAA LHEYLDLLPD VDGVPANAVL       480
     TALAYAEAPG MPLDLWRVTI SALGHAVPSE KHLLAFARSS AANFLVETST SDPQNAVFRL       540
     FHQALNDALV RQRSAVRDEG AIASALLQHG QSVGWSEAPA YLLRALPRHA ERGRSVDQLL       600
     SDPTFALYAD LRRLIPAATS ASSPHARRQA RLLRRTLRAL DASPSDRAAL LSVTETLDNL       660
     GNTYSTSAHP APYRARWAAA VPHEEEAILE GHRDWVRTVC SVEAAGRQLL ATASDDATVR       720
     LWDPETGELV RVLEGHSDYV LTVRTVATEQ GKLLLTTSAD GTARVWDPNQ GETVRRFDGI       780
     GDWVRSACIG RMAGRTVLAT ASDDRVVRFW NMDTGREIRT VKAHHRHRIR AVCALGEVFA       840
     AAGDDGLIRL LDPRGGESIV LRGHGGSVNA LCAFFLDERA MLATASADGT ARVWDLESAS       900
     QHVVLKGHRE ELNAVHAFSL EGRTVLATAS DDGTARLWDP KTGNQLAVFN GHVDWVLDVC       960
     SLPLGGRTQL ATAGSDGTVR LWNPNREQHA GLRGSTSVGA ACALPLEAGT ALATASNNGA      1020
     VSLVNPETGE QLRTIKGSHG WDSCVCAVPV KGRTLLATSS TDRSARVWDP ETSRQVRVLK      1080
     GHGSRVKSMC ILTSKGRTLL ATGSADATAR LWNPENGKQL RVLKGHTGWV LTMCVIPMDD      1140
     RSVLATGSAD GTARLWDPES GRQLHMVKDP SGRVQSMCAV DVGGRAVLAA AGRGTIGLWN      1200
     PANGEQLRIL ESNSEVRSMC AIGVNGRSLL AVASDDRTVR LWDPANGQTV AEIPVGAAGR      1260
     VVIEAGGLLL VSTWRGILAL DLASRGLF                                         1288
//

If you have problems or comments...

PBIL Back to PBIL home page