(data stored in ACNUC7421 zone)

EMBL: AP009493.PE687

AP009493.PE687       Location/Qualifiers
FT   CDS             complement(815987..816319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_687"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17516"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRU8"
FT                   /protein_id="BAG17516.1"
FT                   /translation="MRGRRMASQVVSYQADEETEVRFEIETTDEWYPVSSDEVVGRIRE
FT                   AVRPAVEGARTVLEQVKALQPGEVQVKFGVKVTGTANWLVAKAATEANFEITLIWPRDQ
FT                   AASSAT"
     MRGRRMASQV VSYQADEETE VRFEIETTDE WYPVSSDEVV GRIREAVRPA VEGARTVLEQ        60
     VKALQPGEVQ VKFGVKVTGT ANWLVAKAAT EANFEITLIW PRDQAASSAT                  110
//

If you have problems or comments...

PBIL Back to PBIL home page