(data stored in ACNUC7421 zone)

EMBL: AP009493.PE691

AP009493.PE691       Location/Qualifiers
FT   CDS             complement(819395..819703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_691"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17520"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRV2"
FT                   /protein_id="BAG17520.1"
FT                   /translation="MREARRMSSVGGMSHPQSYELLLIPDHSRTRTGAPGRPIRSAVVA
FT                   ATGETGASGYPRYAGEGMEADVDPETRTVEAVLIDGEELDYGMSVRVAGAQGERPAS"
     MREARRMSSV GGMSHPQSYE LLLIPDHSRT RTGAPGRPIR SAVVAATGET GASGYPRYAG        60
     EGMEADVDPE TRTVEAVLID GEELDYGMSV RVAGAQGERP AS                          102
//

If you have problems or comments...

PBIL Back to PBIL home page