(data stored in ACNUC7421 zone)

EMBL: AP009493.PE693

AP009493.PE693       Location/Qualifiers
FT   CDS             820891..821358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_693"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_693"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17522"
FT                   /db_xref="GOA:B1VRV4"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRV4"
FT                   /protein_id="BAG17522.1"
FT                   /translation="MTFHDSAYRSDNPFDVPGSSGPTATTEADTDDVGPVRTSYAPDRD
FT                   GDPDPGEIVWTWVPFEENDGRGKDRPVLVVAREEAGTLLGVQLSSKRHDGEHEWVALGA
FT                   GPWDSSGRPSWAGLDRVLRVHEDGMRREACALDRERFDRVAGRLRERYGWS"
     MTFHDSAYRS DNPFDVPGSS GPTATTEADT DDVGPVRTSY APDRDGDPDP GEIVWTWVPF        60
     EENDGRGKDR PVLVVAREEA GTLLGVQLSS KRHDGEHEWV ALGAGPWDSS GRPSWAGLDR       120
     VLRVHEDGMR REACALDRER FDRVAGRLRE RYGWS                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page