(data stored in ACNUC7421 zone)

EMBL: AP009493.PE694

AP009493.PE694       Location/Qualifiers
FT   CDS             complement(821472..822293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_694"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_694"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17523"
FT                   /db_xref="InterPro:IPR012664"
FT                   /db_xref="InterPro:IPR019261"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRV5"
FT                   /protein_id="BAG17523.1"
FT                   /translation="MSARLRGIARDTEAVVEAGRYRNAAGQDVPIGRAVAAALSGTKLY
FT                   GPEPVHVAALDTDRTPRIEVTGESSLAAARRMTGEAPGRVAVLSFASARNPGGGYLNGA
FT                   QAQEEALCRASALHATLLRAPEYYAHHRAERGAFYTDRVIHSPGVPVFRDDRGAFLDAP
FT                   YTVGFLTSPAPNAGVIRRQTPEEAHRVPAVLASRAERVLEVAAVRGYRRLVLGAWGCGV
FT                   FQNEPAQVARAFRALLGEGGRFGGHFEQIVFGILDRAPESAARAAFARAFT"
     MSARLRGIAR DTEAVVEAGR YRNAAGQDVP IGRAVAAALS GTKLYGPEPV HVAALDTDRT        60
     PRIEVTGESS LAAARRMTGE APGRVAVLSF ASARNPGGGY LNGAQAQEEA LCRASALHAT       120
     LLRAPEYYAH HRAERGAFYT DRVIHSPGVP VFRDDRGAFL DAPYTVGFLT SPAPNAGVIR       180
     RQTPEEAHRV PAVLASRAER VLEVAAVRGY RRLVLGAWGC GVFQNEPAQV ARAFRALLGE       240
     GGRFGGHFEQ IVFGILDRAP ESAARAAFAR AFT                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page