(data stored in ACNUC7421 zone)

EMBL: AP009493.PE696

AP009493.PE696       Location/Qualifiers
FT   CDS             823807..825210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_696"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_696"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17525"
FT                   /db_xref="GOA:B1VRV7"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR032890"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRV7"
FT                   /protein_id="BAG17525.1"
FT                   /translation="MTDHREGTRHREHSDAFDPAGSTASTGFPVAAGIDPEALRRQALA
FT                   ALLSARERTALLTDSVDDGELTAQHSPLMSPLVWDLAHIGNQEEQWLLRAVGGRQALRP
FT                   EIDGLYNAFEHSRASRPSLPLLAPAEARTYASDVRGRALDLLEGVPLHEGGRPLERAGF
FT                   AFGMIAQHEQQHDETMLITHQLRSGPAALTAPEPPAPVEAEVLGDEVLVPGGPFTMGTS
FT                   AEPWALDNERPAHRREVAAFHLDTSPVTCGAYLRFIEDGGYGDSRWWAPEGWAMVREHD
FT                   LTAPLFWRREAGQWLRRRFGVTEPVPQDEPVLHVSWYEADAYARWAGRRLPTESEWEKA
FT                   ARHDPVSDRSRRYPWGDGDPTPERANLGQRHLRPARSGAYPAGRSPSGAGQLIGDVWEW
FT                   TSSDFLPYPGFVAFPYREYSEVFFGPGHKVLRGGSFAVGEVACRGTFRNWDLPVRRQIF
FT                   SGFRTARSA"
     MTDHREGTRH REHSDAFDPA GSTASTGFPV AAGIDPEALR RQALAALLSA RERTALLTDS        60
     VDDGELTAQH SPLMSPLVWD LAHIGNQEEQ WLLRAVGGRQ ALRPEIDGLY NAFEHSRASR       120
     PSLPLLAPAE ARTYASDVRG RALDLLEGVP LHEGGRPLER AGFAFGMIAQ HEQQHDETML       180
     ITHQLRSGPA ALTAPEPPAP VEAEVLGDEV LVPGGPFTMG TSAEPWALDN ERPAHRREVA       240
     AFHLDTSPVT CGAYLRFIED GGYGDSRWWA PEGWAMVREH DLTAPLFWRR EAGQWLRRRF       300
     GVTEPVPQDE PVLHVSWYEA DAYARWAGRR LPTESEWEKA ARHDPVSDRS RRYPWGDGDP       360
     TPERANLGQR HLRPARSGAY PAGRSPSGAG QLIGDVWEWT SSDFLPYPGF VAFPYREYSE       420
     VFFGPGHKVL RGGSFAVGEV ACRGTFRNWD LPVRRQIFSG FRTARSA                     467
//

If you have problems or comments...

PBIL Back to PBIL home page