(data stored in ACNUC7421 zone)

EMBL: AP009493.PE697

AP009493.PE697       Location/Qualifiers
FT   CDS             825210..825965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_697"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_697"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17526"
FT                   /db_xref="GOA:B1VRV8"
FT                   /db_xref="InterPro:IPR017808"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR032889"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRV8"
FT                   /protein_id="BAG17526.1"
FT                   /translation="MCRHIAYVGDPVALGEILLRPPHALVRQSWAPRRQRHGTVNADGF
FT                   GVGWYAEGDPVPGRYRRQGPIWGDETFADLARVVRSTALLAAVRDATEAGADGEAAAAP
FT                   YTAGRQLFSHNGMVRGWPGSLADAAAALPAERLLALAARNDSALIWALIRHRTDAGDDA
FT                   PRAVAETVREVAAAAPGSRLNLLLTDGETITATAWGDTLWYLTTPGRRTAVASEPYDDD
FT                   PLWREVPDRTLLVATSTDVLLTPLKEPTA"
     MCRHIAYVGD PVALGEILLR PPHALVRQSW APRRQRHGTV NADGFGVGWY AEGDPVPGRY        60
     RRQGPIWGDE TFADLARVVR STALLAAVRD ATEAGADGEA AAAPYTAGRQ LFSHNGMVRG       120
     WPGSLADAAA ALPAERLLAL AARNDSALIW ALIRHRTDAG DDAPRAVAET VREVAAAAPG       180
     SRLNLLLTDG ETITATAWGD TLWYLTTPGR RTAVASEPYD DDPLWREVPD RTLLVATSTD       240
     VLLTPLKEPT A                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page