(data stored in ACNUC7421 zone)

EMBL: AP009493.PE698

AP009493.PE698       Location/Qualifiers
FT   CDS             825962..826924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_698"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_698"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17527"
FT                   /db_xref="GOA:B1VRV9"
FT                   /db_xref="InterPro:IPR017804"
FT                   /db_xref="InterPro:IPR019257"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032888"
FT                   /db_xref="InterPro:IPR035094"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRV9"
FT                   /protein_id="BAG17527.1"
FT                   /translation="MSPFLLTRTLPVDATGAALRADVLSGLTRHPKTLPPKWFYDARGS
FT                   ELFEEITRLPEYYPTRAEREILQARAEEIAAASGARTVIELGSGSSEKTRHLLDVLPEL
FT                   HSYVPVDVSESALTGAAESLLVEHPGLSVHALIADFTGGLALPGTPGPRLVVFLGGTIG
FT                   NLLPEERAGFLRSVRSLLSPGDALLLGTDLVKDEETLVAAYDDAAGVTAAFNKNVLSVV
FT                   NRELGADFPLDDFDHLAVWNPRDRWIEMRLRARRALNVKIRELDLVVPFEAGEELRTEV
FT                   SAKFRREDVREELAAAGMRLTQWWTDSAGRFALSLATAV"
     MSPFLLTRTL PVDATGAALR ADVLSGLTRH PKTLPPKWFY DARGSELFEE ITRLPEYYPT        60
     RAEREILQAR AEEIAAASGA RTVIELGSGS SEKTRHLLDV LPELHSYVPV DVSESALTGA       120
     AESLLVEHPG LSVHALIADF TGGLALPGTP GPRLVVFLGG TIGNLLPEER AGFLRSVRSL       180
     LSPGDALLLG TDLVKDEETL VAAYDDAAGV TAAFNKNVLS VVNRELGADF PLDDFDHLAV       240
     WNPRDRWIEM RLRARRALNV KIRELDLVVP FEAGEELRTE VSAKFRREDV REELAAAGMR       300
     LTQWWTDSAG RFALSLATAV                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page