(data stored in ACNUC7421 zone)

EMBL: AP009493.PE7

AP009493.PE7         Location/Qualifiers
FT   CDS             complement(7112..7642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_7t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_7t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16836"
FT                   /db_xref="GOA:B1VKK5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKK5"
FT                   /protein_id="BAG16836.1"
FT                   /translation="MKVKKDLDCEECIMIWSAGQKFREGDVCKGVVSDVFDFGVFVDLG
FT                   GCVGFVNPSEITWIRYTEITEVICEGREVNFLVIGHALAREQVLLSIKGLEEDPIKKFA
FT                   RERFGASFTGSVEMVTPVGLHVSLPGGMGGLLPESAMAGTADRYRVGDEISVEVARINL
FT                   HDRQIELSLRTPT"
     MKVKKDLDCE ECIMIWSAGQ KFREGDVCKG VVSDVFDFGV FVDLGGCVGF VNPSEITWIR        60
     YTEITEVICE GREVNFLVIG HALAREQVLL SIKGLEEDPI KKFARERFGA SFTGSVEMVT       120
     PVGLHVSLPG GMGGLLPESA MAGTADRYRV GDEISVEVAR INLHDRQIEL SLRTPT           176
//

If you have problems or comments...

PBIL Back to PBIL home page