(data stored in ACNUC7421 zone)

EMBL: AP009493.PE702

AP009493.PE702       Location/Qualifiers
FT   CDS             complement(830491..830979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_702"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_702"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17531"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRW3"
FT                   /protein_id="BAG17531.1"
FT                   /translation="MDTDARPLAVFDLDGTLADTAHRQHFLEGPKRDWSGFFAAAVDDP
FT                   PLAEGVRMVLASAEECRIVYLTGRPERCRRDTVAWLSRQGLPEGTLFMRRNDDRRPARR
FT                   TKLDVLRQLGRKERVRMLVDDDELVCDAAQVAGFPVVRALWADPSAALKDAQEREGRT"
     MDTDARPLAV FDLDGTLADT AHRQHFLEGP KRDWSGFFAA AVDDPPLAEG VRMVLASAEE        60
     CRIVYLTGRP ERCRRDTVAW LSRQGLPEGT LFMRRNDDRR PARRTKLDVL RQLGRKERVR       120
     MLVDDDELVC DAAQVAGFPV VRALWADPSA ALKDAQEREG RT                          162
//

If you have problems or comments...

PBIL Back to PBIL home page