(data stored in ACNUC7421 zone)

EMBL: AP009493.PE704

AP009493.PE704       Location/Qualifiers
FT   CDS             832408..834825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_704"
FT                   /product="putative excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_704"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17533"
FT                   /db_xref="GOA:B1VRW5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRW5"
FT                   /protein_id="BAG17533.1"
FT                   /translation="MHSPHDPYVRVRGAREHNLKNVRVDIPRDTLTVFTGVSGSGKSSL
FT                   AFGTIYAEAQRRYFESVAPYARRLIHQVGAPAVGEITGLPPAVSLEQRRSAPGARSSVG
FT                   TVTTLSNSLRLLFSRAGDYPPGAERLDSDSFSPNTAVGACPECHGLGRIHRTDEALLVP
FT                   DPSLSIREGAIAAWPGAWQGKNLRDVLDALGHDVDRPWRELDPKDREWILFTDEQPVVT
FT                   VHPVRDAGRIQRPYQGTYMSARRYVLHTFADTRSRALRAKAERFLTSAPCPVCGGSRLR
FT                   PEAMAVTFAGRTIAELAGLPLSALAEVLSGAGAGGEETARVLTADLLARIGTVTELGLG
FT                   YLSLDRTAPTLSSGELQRLRLATQLRSGLFGVVYVLDEPSAGLHPADTEALLGVLGRLK
FT                   EAGNSVFVVEHQMDVVRRADWLVDVGPLAGEHGGRVLHSGPPEGLARVPESATRRFLFE
FT                   EGPAPVREPRVPTGWIRLSGVERHNVRGADAAFPLGVFTAVTGVSGSGKSTLVGQVLAG
FT                   VLADRQAGEEATGAGERFCASVTGLEAVDRLVQVDQKPIGRTPRSNLATYTGLFDAVRK
FT                   LFAGTDAARERGYTAGRFSFNVSGGRCETCQGEGFVSVELLFLPSTYAPCPDCHGARYN
FT                   PRTLDVTLNGLTIAQVLELTVESAASFFAGTPAAERALTTLLDVGLGYLRLGQPATELS
FT                   GGEAQRIKLAAELQRTRRGHTLYLLDEPTTGLHPADVEVLMRQLHSLVDAGGTVVVVEH
FT                   DMAVVAGADHVIDLGPEGGDRGGRIVAAGTPAEVAREAGSRTAPYLAKALRH"
     MHSPHDPYVR VRGAREHNLK NVRVDIPRDT LTVFTGVSGS GKSSLAFGTI YAEAQRRYFE        60
     SVAPYARRLI HQVGAPAVGE ITGLPPAVSL EQRRSAPGAR SSVGTVTTLS NSLRLLFSRA       120
     GDYPPGAERL DSDSFSPNTA VGACPECHGL GRIHRTDEAL LVPDPSLSIR EGAIAAWPGA       180
     WQGKNLRDVL DALGHDVDRP WRELDPKDRE WILFTDEQPV VTVHPVRDAG RIQRPYQGTY       240
     MSARRYVLHT FADTRSRALR AKAERFLTSA PCPVCGGSRL RPEAMAVTFA GRTIAELAGL       300
     PLSALAEVLS GAGAGGEETA RVLTADLLAR IGTVTELGLG YLSLDRTAPT LSSGELQRLR       360
     LATQLRSGLF GVVYVLDEPS AGLHPADTEA LLGVLGRLKE AGNSVFVVEH QMDVVRRADW       420
     LVDVGPLAGE HGGRVLHSGP PEGLARVPES ATRRFLFEEG PAPVREPRVP TGWIRLSGVE       480
     RHNVRGADAA FPLGVFTAVT GVSGSGKSTL VGQVLAGVLA DRQAGEEATG AGERFCASVT       540
     GLEAVDRLVQ VDQKPIGRTP RSNLATYTGL FDAVRKLFAG TDAARERGYT AGRFSFNVSG       600
     GRCETCQGEG FVSVELLFLP STYAPCPDCH GARYNPRTLD VTLNGLTIAQ VLELTVESAA       660
     SFFAGTPAAE RALTTLLDVG LGYLRLGQPA TELSGGEAQR IKLAAELQRT RRGHTLYLLD       720
     EPTTGLHPAD VEVLMRQLHS LVDAGGTVVV VEHDMAVVAG ADHVIDLGPE GGDRGGRIVA       780
     AGTPAEVARE AGSRTAPYLA KALRH                                             805
//

If you have problems or comments...

PBIL Back to PBIL home page