(data stored in ACNUC7421 zone)

EMBL: AP009493.PE705

AP009493.PE705       Location/Qualifiers
FT   CDS             complement(834890..835636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_705"
FT                   /product="putative succinate dehydrogenase iron-sulfur
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_705"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17534"
FT                   /db_xref="GOA:B1VRW6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRW6"
FT                   /protein_id="BAG17534.1"
FT                   /translation="MKLTLRVWRQQNPETPGAMATYEVDNISADMSFLEMLDTLNEELT
FT                   LAGDEPVAFDHDCREGICGACSLVINGDAHGPERTTTCQLHMRSFADGDTIDIEPWRAS
FT                   AFPVIKDLVVDRSSFDRIIQSGGYISAPTGTAPDAHATPVPKPDADFAFEHAECIGCGA
FT                   CVAACPNGSAMLFTSAKVNHLNVLPQGAPERETRVLDMVAQMDEEGFGGCTLTGECATA
FT                   CPKGIPLPSIAAMNKEWLRATRKVRR"
     MKLTLRVWRQ QNPETPGAMA TYEVDNISAD MSFLEMLDTL NEELTLAGDE PVAFDHDCRE        60
     GICGACSLVI NGDAHGPERT TTCQLHMRSF ADGDTIDIEP WRASAFPVIK DLVVDRSSFD       120
     RIIQSGGYIS APTGTAPDAH ATPVPKPDAD FAFEHAECIG CGACVAACPN GSAMLFTSAK       180
     VNHLNVLPQG APERETRVLD MVAQMDEEGF GGCTLTGECA TACPKGIPLP SIAAMNKEWL       240
     RATRKVRR                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page