(data stored in ACNUC7421 zone)

EMBL: AP009493.PE706

AP009493.PE706       Location/Qualifiers
FT   CDS             complement(835633..837582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_706"
FT                   /product="putative succinate dehydrogenase flavoprotein
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_706"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17535"
FT                   /db_xref="GOA:B1VRW7"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011280"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRW7"
FT                   /protein_id="BAG17535.1"
FT                   /translation="MPDYTQYATGEPVVDTKAPEGPVNERWDTRRFQAKLVNPANRRKH
FT                   TVIVVGTGLAGGAAGATLAEQGYHVVQFCFQDSPRRAHSVAAQGGINAAKNYRNDGDSI
FT                   HRLFYDTVKGGDFRARESNVHRLAQISVEIIDQCVAQGVPFAREYGGLLDNRSFGGVQV
FT                   SRTFYARGQTGQQLLLGAYQALSRQIASGGVELHARTEMLDLIVVDGKARGIVTRDLVT
FT                   GKIDTYFADAVVLATGGYGNVFYLSTNAMNSNATAIWRAHRRGAYMANPCFTQIHPTCI
FT                   PRTGDHQSKLTLMSESLRNDGRIWVPKAKGDDRPADKIPEDERDYYLERIYPAFGNLVP
FT                   RDIASRAAKNVCDEGRGVGPGGQGVYLDFAEAIQRMGRKAVEAKYGNLFDMYQRITDED
FT                   PYTVPMRIYPAVHYTMGGLWVDYDLQTTIPGLFAIGEANFSDHGANRLGASALMQGLAD
FT                   GYFVLPSTINDYLARNPHTDTVDAAHPAVAEAVAETEDRINLLLSVDGDRTPDSFHREI
FT                   GELMWEYCGMARTDDGLRKALARIPEIREEFWRRIKVPGTGEQFNQSLEKANRIVDYLE
FT                   LAELMCLDALHRAESCGGHFREESQTPDGEAERRDEEFSYAAAWEFTATGGAPVLHKED
FT                   LVFEYVHPTQRSYA"
     MPDYTQYATG EPVVDTKAPE GPVNERWDTR RFQAKLVNPA NRRKHTVIVV GTGLAGGAAG        60
     ATLAEQGYHV VQFCFQDSPR RAHSVAAQGG INAAKNYRND GDSIHRLFYD TVKGGDFRAR       120
     ESNVHRLAQI SVEIIDQCVA QGVPFAREYG GLLDNRSFGG VQVSRTFYAR GQTGQQLLLG       180
     AYQALSRQIA SGGVELHART EMLDLIVVDG KARGIVTRDL VTGKIDTYFA DAVVLATGGY       240
     GNVFYLSTNA MNSNATAIWR AHRRGAYMAN PCFTQIHPTC IPRTGDHQSK LTLMSESLRN       300
     DGRIWVPKAK GDDRPADKIP EDERDYYLER IYPAFGNLVP RDIASRAAKN VCDEGRGVGP       360
     GGQGVYLDFA EAIQRMGRKA VEAKYGNLFD MYQRITDEDP YTVPMRIYPA VHYTMGGLWV       420
     DYDLQTTIPG LFAIGEANFS DHGANRLGAS ALMQGLADGY FVLPSTINDY LARNPHTDTV       480
     DAAHPAVAEA VAETEDRINL LLSVDGDRTP DSFHREIGEL MWEYCGMART DDGLRKALAR       540
     IPEIREEFWR RIKVPGTGEQ FNQSLEKANR IVDYLELAEL MCLDALHRAE SCGGHFREES       600
     QTPDGEAERR DEEFSYAAAW EFTATGGAPV LHKEDLVFEY VHPTQRSYA                   649
//

If you have problems or comments...

PBIL Back to PBIL home page