(data stored in ACNUC7421 zone)

EMBL: AP009493.PE707

AP009493.PE707       Location/Qualifiers
FT   CDS             complement(837584..838288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_707"
FT                   /product="putative cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_707"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17536"
FT                   /db_xref="GOA:B1VRW8"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR011138"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRW8"
FT                   /protein_id="BAG17536.1"
FT                   /translation="MALATRTDRRPSMTRTLWDSTVGKKTIMAVTGLVMLGYLVAHMVG
FT                   NLKIFFGPGEFDGYAHWLRTMGEPVLHYEWALWLVRVGLVAAVVLHGVSAYQLSRRDIK
FT                   ARPAKYVHKKPRASYATRTMRWGGIILALFIVWHILDLTTGTVHTSFEAGHPYQNVIDT
FT                   FSTWYGNVIYIVAVLAMGLHVQHGFWSAAQTLGVGNATRDRILKTLANLLAAVLTVGFI
FT                   SVPVAVMTGVVS"
     MALATRTDRR PSMTRTLWDS TVGKKTIMAV TGLVMLGYLV AHMVGNLKIF FGPGEFDGYA        60
     HWLRTMGEPV LHYEWALWLV RVGLVAAVVL HGVSAYQLSR RDIKARPAKY VHKKPRASYA       120
     TRTMRWGGII LALFIVWHIL DLTTGTVHTS FEAGHPYQNV IDTFSTWYGN VIYIVAVLAM       180
     GLHVQHGFWS AAQTLGVGNA TRDRILKTLA NLLAAVLTVG FISVPVAVMT GVVS             234
//

If you have problems or comments...

PBIL Back to PBIL home page