(data stored in ACNUC7421 zone)

EMBL: AP009493.PE709

AP009493.PE709       Location/Qualifiers
FT   CDS             complement(839321..841495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_709"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_709"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17538"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRX0"
FT                   /protein_id="BAG17538.1"
FT                   /translation="MSIPAQASGEPDAEPDGPEGRLRRFARIWSRAIFPLTATSLTRPE
FT                   FEQHLLPLARELNGILHAHPFDASPAQRIGEALIEAHCTDPDALSSTLGVVDSYLVLYC
FT                   GGNGPGVLTTEDGRARCARIQHTLAAGFTGALRERTLAEQEAIARSALTARSDAEQALH
FT                   ATEARFRAVFKDAAIGIGIADLDGNILEINDTLTKMFGGLEHHVRSHKVNEWVHPEDSP
FT                   QVWKYYDELVRGERDHYRVEKAYYRNDGTVLWTNLTVSLLRDSEGRPEYQLALMEDTTE
FT                   RRLLNLRLRYEATHDALTGLPNRTLFFERLEKALTAQEGIRFGLCYLDLDGFKAINDSL
FT                   GHAAGDRLLVEVADRLQSCATAPGEMVARLGGDEFVALTTGPDTAEEVDELAGRILNAL
FT                   ASPIRLDGRELTVRGSIGVVEGPSGERSAAEVLRSADITMYRAKAAGGNRYQLADAEAD
FT                   ARAITRHGLTTALPAALDRGEFFIEYQPLVHLDDGTVHGAEALVRWCHPQHGVLGPDRF
FT                   IPLAEHTGLIVPLGRWVLEESVRQANFWQERHSDGGPLRINVNLSPTQLHHPRLVAETV
FT                   DVLERSGLEPGALCLEVTESALIGADDDLLKPLRQLAEMGVDIALDDFGTGYSNLANLR
FT                   RLPVSVLKLDRSFTRGMQQHPADPVDLKIVEGIVSLAHSLELAVTVEGVETGAQAEQLR
FT                   RIGCDTAQGWYYARPGAPDRIHSLLLADAV"
     MSIPAQASGE PDAEPDGPEG RLRRFARIWS RAIFPLTATS LTRPEFEQHL LPLARELNGI        60
     LHAHPFDASP AQRIGEALIE AHCTDPDALS STLGVVDSYL VLYCGGNGPG VLTTEDGRAR       120
     CARIQHTLAA GFTGALRERT LAEQEAIARS ALTARSDAEQ ALHATEARFR AVFKDAAIGI       180
     GIADLDGNIL EINDTLTKMF GGLEHHVRSH KVNEWVHPED SPQVWKYYDE LVRGERDHYR       240
     VEKAYYRNDG TVLWTNLTVS LLRDSEGRPE YQLALMEDTT ERRLLNLRLR YEATHDALTG       300
     LPNRTLFFER LEKALTAQEG IRFGLCYLDL DGFKAINDSL GHAAGDRLLV EVADRLQSCA       360
     TAPGEMVARL GGDEFVALTT GPDTAEEVDE LAGRILNALA SPIRLDGREL TVRGSIGVVE       420
     GPSGERSAAE VLRSADITMY RAKAAGGNRY QLADAEADAR AITRHGLTTA LPAALDRGEF       480
     FIEYQPLVHL DDGTVHGAEA LVRWCHPQHG VLGPDRFIPL AEHTGLIVPL GRWVLEESVR       540
     QANFWQERHS DGGPLRINVN LSPTQLHHPR LVAETVDVLE RSGLEPGALC LEVTESALIG       600
     ADDDLLKPLR QLAEMGVDIA LDDFGTGYSN LANLRRLPVS VLKLDRSFTR GMQQHPADPV       660
     DLKIVEGIVS LAHSLELAVT VEGVETGAQA EQLRRIGCDT AQGWYYARPG APDRIHSLLL       720
     ADAV                                                                    724
//

If you have problems or comments...

PBIL Back to PBIL home page