(data stored in ACNUC7421 zone)

EMBL: AP009493.PE710

AP009493.PE710       Location/Qualifiers
FT   CDS             complement(841492..842310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_710"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17539"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRX1"
FT                   /protein_id="BAG17539.1"
FT                   /translation="MERPAWAPQGIDISVPSVSRMYDFYLGGSHNFEVDREAARKAMEF
FT                   LPGLPKIMQANRAFMRRAVRHAVDIGIDQFLDIGSGIPTFGNVHEVAQAADPGAKVAYV
FT                   DHDPVAVAHSQAVLEGNDRAVIAAADLRRPEEILANPEITGLLDLNRPVALLLVAVLHF
FT                   VEDADDPRGAVAELRESLAPGSLIVLTHASYEGIPLPKEEAAGTVGVYQNIRNPLIMRS
FT                   REEIGQFFEGYEMVEPGLVSMPEWRPDTPQAPQQEDPYAFSGFAGVGRKA"
     MERPAWAPQG IDISVPSVSR MYDFYLGGSH NFEVDREAAR KAMEFLPGLP KIMQANRAFM        60
     RRAVRHAVDI GIDQFLDIGS GIPTFGNVHE VAQAADPGAK VAYVDHDPVA VAHSQAVLEG       120
     NDRAVIAAAD LRRPEEILAN PEITGLLDLN RPVALLLVAV LHFVEDADDP RGAVAELRES       180
     LAPGSLIVLT HASYEGIPLP KEEAAGTVGV YQNIRNPLIM RSREEIGQFF EGYEMVEPGL       240
     VSMPEWRPDT PQAPQQEDPY AFSGFAGVGR KA                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page