(data stored in ACNUC7421 zone)

EMBL: AP009493.PE711

AP009493.PE711       Location/Qualifiers
FT   CDS             843720..844484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_711"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_711"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17540"
FT                   /db_xref="GOA:B1VRX2"
FT                   /db_xref="InterPro:IPR025333"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRX2"
FT                   /protein_id="BAG17540.1"
FT                   /translation="MSEWLVLSIAMASACAVVLTIAVLNNRRIADDDDPSETPDVIEYM
FT                   TMMIGVVYAIVLGLAIAGVWEGRSAAQESVRIEAQALHEVQARASVYPAEVRDRIRADV
FT                   DAYVDHVVHDEWKVMSDRNTLTERGTQLLDKVRADVTDYQPKTDHEGQAYQPLVDQVAA
FT                   ADDARSTRGQNAGATMPGVVWFGLIIGALVTVGLIFTLQIRRTFRELLLAGLFSALIAF
FT                   LLFLIWDFDAPFGRGISATADPFLDMFPGVAR"
     MSEWLVLSIA MASACAVVLT IAVLNNRRIA DDDDPSETPD VIEYMTMMIG VVYAIVLGLA        60
     IAGVWEGRSA AQESVRIEAQ ALHEVQARAS VYPAEVRDRI RADVDAYVDH VVHDEWKVMS       120
     DRNTLTERGT QLLDKVRADV TDYQPKTDHE GQAYQPLVDQ VAAADDARST RGQNAGATMP       180
     GVVWFGLIIG ALVTVGLIFT LQIRRTFREL LLAGLFSALI AFLLFLIWDF DAPFGRGISA       240
     TADPFLDMFP GVAR                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page