(data stored in ACNUC7421 zone)

EMBL: AP009493.PE713

AP009493.PE713       Location/Qualifiers
FT   CDS             complement(845318..845800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_713"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_713"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17542"
FT                   /db_xref="GOA:B1VRX4"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRX4"
FT                   /protein_id="BAG17542.1"
FT                   /translation="MRVSRALAVTATAFAAVGLAAPMAAATNGPVNVAVNPQAVHQGGS
FT                   LKITAQGCGHGGKVWSNAFPTTTLSPGDGTNFAHARVRNNTTPGQYHLSVKCSDNDRIA
FT                   THKFTVLAGNGAQGGLGGSMGPSSVEMQVGGGLVAAAAVGGAVFLVRRRRPGHAAF"
     MRVSRALAVT ATAFAAVGLA APMAAATNGP VNVAVNPQAV HQGGSLKITA QGCGHGGKVW        60
     SNAFPTTTLS PGDGTNFAHA RVRNNTTPGQ YHLSVKCSDN DRIATHKFTV LAGNGAQGGL       120
     GGSMGPSSVE MQVGGGLVAA AAVGGAVFLV RRRRPGHAAF                             160
//

If you have problems or comments...

PBIL Back to PBIL home page