(data stored in ACNUC7421 zone)

EMBL: AP009493.PE714

AP009493.PE714       Location/Qualifiers
FT   CDS             846138..846800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_714"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_714"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17543"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRX5"
FT                   /protein_id="BAG17543.1"
FT                   /translation="MGRDYAGAERTRRVPWGAIALVLLSGLALMRNGTEFGESGPPQPA
FT                   AAASLDLGKDTAGPPVEGEPVQPLPYAPASRVKVPSIDVDAPIIDVNLDANGWIDAPPA
FT                   EDPNLAGWYQNGIAPGQRGTAVVVGHVDNNSGPAVFYGLGSLQKGHRVEVDRYDGRVGI
FT                   FEVYGVEVFSKNDFPGPRVYGDTGHAELRVITCGGGYSKAGGYDGNVVVFARLVDTR"
     MGRDYAGAER TRRVPWGAIA LVLLSGLALM RNGTEFGESG PPQPAAAASL DLGKDTAGPP        60
     VEGEPVQPLP YAPASRVKVP SIDVDAPIID VNLDANGWID APPAEDPNLA GWYQNGIAPG       120
     QRGTAVVVGH VDNNSGPAVF YGLGSLQKGH RVEVDRYDGR VGIFEVYGVE VFSKNDFPGP       180
     RVYGDTGHAE LRVITCGGGY SKAGGYDGNV VVFARLVDTR                             220
//

If you have problems or comments...

PBIL Back to PBIL home page