(data stored in ACNUC7421 zone)

EMBL: AP009493.PE716

AP009493.PE716       Location/Qualifiers
FT   CDS             847894..848355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_716"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_716"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17545"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRX7"
FT                   /protein_id="BAG17545.1"
FT                   /translation="MTEQQPHRFERGTDGPKVIVAGLDGSDSSMRAAAYAAGLARRQNA
FT                   MLALVYVQPVMTAGAALGVPVSDATVEVAEDLVSEIRAATERFSDAWDMRWEFHTFRGD
FT                   PYNGLVTAADELKADAVVVGASESAGHRFVGSVAVRLVKAGRWPVTVVP"
     MTEQQPHRFE RGTDGPKVIV AGLDGSDSSM RAAAYAAGLA RRQNAMLALV YVQPVMTAGA        60
     ALGVPVSDAT VEVAEDLVSE IRAATERFSD AWDMRWEFHT FRGDPYNGLV TAADELKADA       120
     VVVGASESAG HRFVGSVAVR LVKAGRWPVT VVP                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page