(data stored in ACNUC7421 zone)

EMBL: AP009493.PE717

AP009493.PE717       Location/Qualifiers
FT   CDS             complement(848363..849562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_717"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_717"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17546"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRX8"
FT                   /protein_id="BAG17546.1"
FT                   /translation="MTLRIRPGTATAIALLLAAATGCTGQQPAAPDPTGPPGAARGAGG
FT                   QDAAGPRPFTLLAAGDILPHSSVIDRAAVDAGGAGYDFAPMLAGVAPVVSAADLAFCHM
FT                   ETVYGEEGGPYTGYPSFKSPPEVAAALRTTGYDSCSTASNHTLDDGAEGVSRTLAALDA
FT                   AGIRHAGSARTAAEAARPTILPAGPGENAARVAHLAYTYGTNDIPVPADRPWTVNVTDE
FT                   RKIVEEARAARRAGADVVVLSVHWGTEWQDEPDATQRDLAQRLTASAYGGRPDIDLIIG
FT                   THAHVPQAYEKVNGTWVVYGMGDQIAGAMINYEGVQDPRGNQGSMGRFTFAPPAKPGER
FT                   WTVKKAEFVPQWYDTDTGRTVNLNASPGDGDERLREIRDRIRTVVLGRGAEGDGLLMGR
FT                   "
     MTLRIRPGTA TAIALLLAAA TGCTGQQPAA PDPTGPPGAA RGAGGQDAAG PRPFTLLAAG        60
     DILPHSSVID RAAVDAGGAG YDFAPMLAGV APVVSAADLA FCHMETVYGE EGGPYTGYPS       120
     FKSPPEVAAA LRTTGYDSCS TASNHTLDDG AEGVSRTLAA LDAAGIRHAG SARTAAEAAR       180
     PTILPAGPGE NAARVAHLAY TYGTNDIPVP ADRPWTVNVT DERKIVEEAR AARRAGADVV       240
     VLSVHWGTEW QDEPDATQRD LAQRLTASAY GGRPDIDLII GTHAHVPQAY EKVNGTWVVY       300
     GMGDQIAGAM INYEGVQDPR GNQGSMGRFT FAPPAKPGER WTVKKAEFVP QWYDTDTGRT       360
     VNLNASPGDG DERLREIRDR IRTVVLGRGA EGDGLLMGR                              399
//

If you have problems or comments...

PBIL Back to PBIL home page