(data stored in ACNUC7421 zone)

EMBL: AP009493.PE720

AP009493.PE720       Location/Qualifiers
FT   CDS             complement(851159..852349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_720"
FT                   /product="putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_720"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17549"
FT                   /db_xref="GOA:B1VRY1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRY1"
FT                   /protein_id="BAG17549.1"
FT                   /translation="MTGAALAALAVPAVLLLGAGYLVGRRTARPLRPSDVGTPVEHATF
FT                   ETLHTASLAAPPLRAGLTEESARRAARRLRSLLGTDALCLTDRDRVLVWDGAGHHHGKD
FT                   VMEHLRVLLDNGRGTAFDSGCADLDCPLRWAVAVPLTVENRVLGALVAYAPRESAVLAR
FT                   AAGEVARWVCVQLELAELDRSRTQLIEAEIKALRAQISPHFIFNSLAAIASFVRTDPEQ
FT                   ARELLLEFADFTRYSFRKHGEFTTLADELHSIDQYLALVRARFGERLAVTLQVAPEVLP
FT                   VALPFLCLQPLVENAVKHGLEGAVTRSRITISALDAGSEAEVVIEDDGTGMDPERLRQI
FT                   LRGEGGASTGIGLLNVDERLRQVYGDAYGLVIETGIGAGMKITLRLPKYRAGVHGS"
     MTGAALAALA VPAVLLLGAG YLVGRRTARP LRPSDVGTPV EHATFETLHT ASLAAPPLRA        60
     GLTEESARRA ARRLRSLLGT DALCLTDRDR VLVWDGAGHH HGKDVMEHLR VLLDNGRGTA       120
     FDSGCADLDC PLRWAVAVPL TVENRVLGAL VAYAPRESAV LARAAGEVAR WVCVQLELAE       180
     LDRSRTQLIE AEIKALRAQI SPHFIFNSLA AIASFVRTDP EQARELLLEF ADFTRYSFRK       240
     HGEFTTLADE LHSIDQYLAL VRARFGERLA VTLQVAPEVL PVALPFLCLQ PLVENAVKHG       300
     LEGAVTRSRI TISALDAGSE AEVVIEDDGT GMDPERLRQI LRGEGGASTG IGLLNVDERL       360
     RQVYGDAYGL VIETGIGAGM KITLRLPKYR AGVHGS                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page