(data stored in ACNUC7421 zone)

EMBL: AP009493.PE722

AP009493.PE722       Location/Qualifiers
FT   CDS             complement(853848..854210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_722"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_722"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17551"
FT                   /db_xref="GOA:B1VRY3"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRY3"
FT                   /protein_id="BAG17551.1"
FT                   /translation="MSAEPSPRREVVTGEPRRVRPLPRYRTQAEIDEQTALGGAYVRSL
FT                   MRGQLRAGLTVFGVLALVAGTLPLLFAALNSSALVWAVLGFATYPPLTLAAWWYVRRAE
FT                   RNERDFARLVEGRPAP"
     MSAEPSPRRE VVTGEPRRVR PLPRYRTQAE IDEQTALGGA YVRSLMRGQL RAGLTVFGVL        60
     ALVAGTLPLL FAALNSSALV WAVLGFATYP PLTLAAWWYV RRAERNERDF ARLVEGRPAP       120
//

If you have problems or comments...

PBIL Back to PBIL home page