(data stored in ACNUC7421 zone)

EMBL: AP009493.PE726

AP009493.PE726       Location/Qualifiers
FT   CDS             complement(857565..859628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_726"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_726"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17555"
FT                   /db_xref="GOA:B1VRY7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRY7"
FT                   /protein_id="BAG17555.1"
FT                   /translation="MDDRVAGALSLPDDWPAHPDLSLALNRMGSFDWDLDTGLMHMDRT
FT                   ALDVFDLTEDEYDDRPDSLAPRVPTDEAQRLDALVSHALKSGRTEYGAYFRIQRRDGTL
FT                   RWTHTQGFVRRDGAGRPHRIIGIVRDATQELADSTARRELDEDRRRRTSLVEGTTAALA
FT                   HARTVKDVIAVLKNSQGLAHLGATSLVMGLLESGRIHLVADGPKGSYVPGTRYTRVDEQ
FT                   YPMSEVVRTLTPRFIESADDFATSYPILWRDISHLEITSAAYMPLIAQARPIGALGLLY
FT                   RDKGGFTEDERNLLMALGTSIAQSLQRAMLYEQEHDLAEGLQQAMLPRRIPAVPGAQVA
FT                   VRYRSARLGRDIGGDWYDLIPLPGGRVGAVIGDVQGHDTHAAAVMGQLRIVLRAYAAEG
FT                   HSPATVMARASVFLHELDTDRFATCTYAEVDLTTGVVQLVRAGHVDPLVRDVDGSCRRM
FT                   PSEGGLPLGLSAEFGRLEYPVGTVELDPGQTMVLFTDGLVELPGSDLDEGMQHLTALVT
FT                   NGPRDLQELADRLCDTVDERGGQDDVAVLLLRRRAAQAPQPGGRLQQHVAQNDPEALRS
FT                   SRHMIRAAVRAWGAKDRADEIELAADELITNALMHTDGGAVVTIRVLAGPERRLRVDVE
FT                   DRSSALPRRRDAGESGVSGRGLMLVDRLADVWGVESRGSGKCVWCEFLIPAR"
     MDDRVAGALS LPDDWPAHPD LSLALNRMGS FDWDLDTGLM HMDRTALDVF DLTEDEYDDR        60
     PDSLAPRVPT DEAQRLDALV SHALKSGRTE YGAYFRIQRR DGTLRWTHTQ GFVRRDGAGR       120
     PHRIIGIVRD ATQELADSTA RRELDEDRRR RTSLVEGTTA ALAHARTVKD VIAVLKNSQG       180
     LAHLGATSLV MGLLESGRIH LVADGPKGSY VPGTRYTRVD EQYPMSEVVR TLTPRFIESA       240
     DDFATSYPIL WRDISHLEIT SAAYMPLIAQ ARPIGALGLL YRDKGGFTED ERNLLMALGT       300
     SIAQSLQRAM LYEQEHDLAE GLQQAMLPRR IPAVPGAQVA VRYRSARLGR DIGGDWYDLI       360
     PLPGGRVGAV IGDVQGHDTH AAAVMGQLRI VLRAYAAEGH SPATVMARAS VFLHELDTDR       420
     FATCTYAEVD LTTGVVQLVR AGHVDPLVRD VDGSCRRMPS EGGLPLGLSA EFGRLEYPVG       480
     TVELDPGQTM VLFTDGLVEL PGSDLDEGMQ HLTALVTNGP RDLQELADRL CDTVDERGGQ       540
     DDVAVLLLRR RAAQAPQPGG RLQQHVAQND PEALRSSRHM IRAAVRAWGA KDRADEIELA       600
     ADELITNALM HTDGGAVVTI RVLAGPERRL RVDVEDRSSA LPRRRDAGES GVSGRGLMLV       660
     DRLADVWGVE SRGSGKCVWC EFLIPAR                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page