(data stored in ACNUC7421 zone)

EMBL: AP009493.PE727

AP009493.PE727       Location/Qualifiers
FT   CDS             complement(859755..860861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_727"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_727"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17556"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRY8"
FT                   /protein_id="BAG17556.1"
FT                   /translation="MRSPRHVRRTALAALSAGVLLAVAGCGGGGDRTAKGTTGTAEAKD
FT                   VLLQPLASPGPGPFTASTALTAASPSPTGGPDADPTSATRTVHRVSGAVPGLYGGTRSV
FT                   AACDVEQQASLLAGDEDKARAFAGASGIEAVQIPGYLKSLTPVVLRADAQVTSHGYSAG
FT                   SATAFQAVLQAGTAVLVDSRGMPRVRCACGNPLAPPVVADGEVAHRGERWPGYDPARVL
FT                   AVEPGVKAATSLIIVNTDDNTWIERAMGDSGGRDRTPDDPPPFEPDADLLFPSPGRPTE
FT                   SAPPDTAPTGPAPSEPQEPTDPGAPEPSDDFGDTPPEEPWEYEEGDPDVAPEPTQVFPA
FT                   EPDGPPEPEAPAAPDEPMEAGLDDVFAG"
     MRSPRHVRRT ALAALSAGVL LAVAGCGGGG DRTAKGTTGT AEAKDVLLQP LASPGPGPFT        60
     ASTALTAASP SPTGGPDADP TSATRTVHRV SGAVPGLYGG TRSVAACDVE QQASLLAGDE       120
     DKARAFAGAS GIEAVQIPGY LKSLTPVVLR ADAQVTSHGY SAGSATAFQA VLQAGTAVLV       180
     DSRGMPRVRC ACGNPLAPPV VADGEVAHRG ERWPGYDPAR VLAVEPGVKA ATSLIIVNTD       240
     DNTWIERAMG DSGGRDRTPD DPPPFEPDAD LLFPSPGRPT ESAPPDTAPT GPAPSEPQEP       300
     TDPGAPEPSD DFGDTPPEEP WEYEEGDPDV APEPTQVFPA EPDGPPEPEA PAAPDEPMEA       360
     GLDDVFAG                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page