(data stored in ACNUC7421 zone)

EMBL: AP009493.PE728

AP009493.PE728       Location/Qualifiers
FT   CDS             861031..861891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_728"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_728"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17557"
FT                   /db_xref="GOA:B1VRY9"
FT                   /db_xref="InterPro:IPR025450"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRY9"
FT                   /protein_id="BAG17557.1"
FT                   /translation="MSALVNAVVMLGMLVIVPTGLRLAERPELDLLRRLWPLFAVPGSV
FT                   ALWLPRGATATALACCYALGTVVLALHAPRRAVRGGHLDPAGIALLTALVTPAVAGVAL
FT                   VAERSGHELFGFDLGILALTVPHFHFAGFAAALVAGLVCRVSDGPAGRFAALSVPLGTL
FT                   LVLVGYFVGDWAELAGALVLTAGMWTVGLLTWRTGLAEGRDRTTRLLLLASAAVLVATM
FT                   LLALSWALGEATGLPHPSLTWMAATHGLGNALGFALCSLLAWRRIRTEEPDRTAGTDRT
FT                   GGRTA"
     MSALVNAVVM LGMLVIVPTG LRLAERPELD LLRRLWPLFA VPGSVALWLP RGATATALAC        60
     CYALGTVVLA LHAPRRAVRG GHLDPAGIAL LTALVTPAVA GVALVAERSG HELFGFDLGI       120
     LALTVPHFHF AGFAAALVAG LVCRVSDGPA GRFAALSVPL GTLLVLVGYF VGDWAELAGA       180
     LVLTAGMWTV GLLTWRTGLA EGRDRTTRLL LLASAAVLVA TMLLALSWAL GEATGLPHPS       240
     LTWMAATHGL GNALGFALCS LLAWRRIRTE EPDRTAGTDR TGGRTA                      286
//

If you have problems or comments...

PBIL Back to PBIL home page