(data stored in ACNUC7421 zone)

EMBL: AP009493.PE729

AP009493.PE729       Location/Qualifiers
FT   CDS             861888..862400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_729"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_729"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17558"
FT                   /db_xref="InterPro:IPR014457"
FT                   /db_xref="InterPro:IPR018960"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRZ0"
FT                   /protein_id="BAG17558.1"
FT                   /translation="MSTLTYPEVGATRLGPLPRGYHHLHHRTRIGRGEADFATAGAAVT
FT                   EWRMHRASGARVESPAPRAEPGGGVRVSLGLGPLRFTAPCQVIWAEYGEDGRTGFGYGT
FT                   LAGHPERGEECFTVDLADDGTVWFTVLAFSRPASWYTRLAGPLVPVVQHWYARRLGRTL
FT                   RRIVAAS"
     MSTLTYPEVG ATRLGPLPRG YHHLHHRTRI GRGEADFATA GAAVTEWRMH RASGARVESP        60
     APRAEPGGGV RVSLGLGPLR FTAPCQVIWA EYGEDGRTGF GYGTLAGHPE RGEECFTVDL       120
     ADDGTVWFTV LAFSRPASWY TRLAGPLVPV VQHWYARRLG RTLRRIVAAS                  170
//

If you have problems or comments...

PBIL Back to PBIL home page