(data stored in ACNUC7421 zone)

EMBL: AP009493.PE730

AP009493.PE730       Location/Qualifiers
FT   CDS             862459..863904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_730"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_730"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17559"
FT                   /db_xref="GOA:B1VRZ1"
FT                   /db_xref="InterPro:IPR009613"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRZ1"
FT                   /protein_id="BAG17559.1"
FT                   /translation="MEWFTADGYWLSRLIFQRALAVVYLVAFLSAALQFRALIGERGML
FT                   PVPELLRRTPWRAAPGIFRLHYSDRFFAAVACSGCAVSVALIAGLDGLLPLWGGMLLWA
FT                   LPWLLYLSIVQVGQVWYGFGWESLLLETGFLAVFLGSGDTGAPVLVLWLLRWLLFRVEF
FT                   GAGLIKVRGDACWRKLTCLDFHHETQPMPGPLSWFFHHLPRPVHRVEAAANHLTQLVVP
FT                   FALFTPQPVASAAAGLMVLTQLWLVLSGNFAWLNWLTIALALSAIDWTPLAGPPPPQVA
FT                   PPLWYGVVVVAATALVLVLSYRPVRNLLSRRQAMNRSYDPLHLVNSYGAFGSISRTRLE
FT                   VVVEGSADPVEREGAEWREYGFRGKPGDPRRLPRLYAPYHLRLDWMMWFAALSPAYARP
FT                   WFGAFAERLLDGDRDTLRLLGHDPFPDGPPRQVRARVFRYRFTGLRELRATGCWWHRTY
FT                   VREFLRPVSRPLPPERETGRRTR"
     MEWFTADGYW LSRLIFQRAL AVVYLVAFLS AALQFRALIG ERGMLPVPEL LRRTPWRAAP        60
     GIFRLHYSDR FFAAVACSGC AVSVALIAGL DGLLPLWGGM LLWALPWLLY LSIVQVGQVW       120
     YGFGWESLLL ETGFLAVFLG SGDTGAPVLV LWLLRWLLFR VEFGAGLIKV RGDACWRKLT       180
     CLDFHHETQP MPGPLSWFFH HLPRPVHRVE AAANHLTQLV VPFALFTPQP VASAAAGLMV       240
     LTQLWLVLSG NFAWLNWLTI ALALSAIDWT PLAGPPPPQV APPLWYGVVV VAATALVLVL       300
     SYRPVRNLLS RRQAMNRSYD PLHLVNSYGA FGSISRTRLE VVVEGSADPV EREGAEWREY       360
     GFRGKPGDPR RLPRLYAPYH LRLDWMMWFA ALSPAYARPW FGAFAERLLD GDRDTLRLLG       420
     HDPFPDGPPR QVRARVFRYR FTGLRELRAT GCWWHRTYVR EFLRPVSRPL PPERETGRRT       480
     R                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page