(data stored in ACNUC7421 zone)

EMBL: AP009493.PE734

AP009493.PE734       Location/Qualifiers
FT   CDS             867320..868576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_734"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_734"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17563"
FT                   /db_xref="GOA:B1VRZ5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRZ5"
FT                   /protein_id="BAG17563.1"
FT                   /translation="MGTSPIPVGIPGIPTQQVGIPHRPESPLWNLDASILLVEDDAGDA
FT                   LLVEEMLTDSELDSALTWCKTLTEARAFLSTATTPVCVLLDLHLPDAHGLDAVRQILES
FT                   DSDAAIVVLTGLEESGTGLRAVAQGAQDYLVKGRLGPEVLSRAVRYALQRKEVERAAAA
FT                   LRANQLIAQENARLELGLLPVPLLRDDRFRARARYEPGRVHGLLSGDFYDVVQTADGTV
FT                   HAVIGDVSGHGAAEAALGVCLRVAWRTAVLCGTSQPEQIALLEEILVAERSDSHVFATV
FT                   TSLVFPPGQRHAQVLRAGHPGLLLREGKDVSWVEPEGGMALGLLPGFGRWPTVDIPLAP
FT                   GAGLVLFTDGLFEGRDGPDSRLGEEGLLAMARANGHLPARSFVDALVAGAAEGAAPYGG
FT                   LADDVAVLHLGWGSESDER"
     MGTSPIPVGI PGIPTQQVGI PHRPESPLWN LDASILLVED DAGDALLVEE MLTDSELDSA        60
     LTWCKTLTEA RAFLSTATTP VCVLLDLHLP DAHGLDAVRQ ILESDSDAAI VVLTGLEESG       120
     TGLRAVAQGA QDYLVKGRLG PEVLSRAVRY ALQRKEVERA AAALRANQLI AQENARLELG       180
     LLPVPLLRDD RFRARARYEP GRVHGLLSGD FYDVVQTADG TVHAVIGDVS GHGAAEAALG       240
     VCLRVAWRTA VLCGTSQPEQ IALLEEILVA ERSDSHVFAT VTSLVFPPGQ RHAQVLRAGH       300
     PGLLLREGKD VSWVEPEGGM ALGLLPGFGR WPTVDIPLAP GAGLVLFTDG LFEGRDGPDS       360
     RLGEEGLLAM ARANGHLPAR SFVDALVAGA AEGAAPYGGL ADDVAVLHLG WGSESDER         418
//

If you have problems or comments...

PBIL Back to PBIL home page