(data stored in ACNUC7421 zone)

EMBL: AP009493.PE735

AP009493.PE735       Location/Qualifiers
FT   CDS             868578..870197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_735"
FT                   /product="putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_735"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17564"
FT                   /db_xref="GOA:B1VRZ6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRZ6"
FT                   /protein_id="BAG17564.1"
FT                   /translation="MTKQPAPGGFAARLSVQNWVHLILGGFIVVVCACLVIGGLVMARI
FT                   SDRTTELVDRIQPARSASFQLQNALLDQETGIRGFALTGDDSFLEPYEAGKAAEQERLA
FT                   QVRRLVGSGGRYADDLDAIAAAAEQWRRSKAEPLIATVREQGPSEAATSARLQRSKADF
FT                   DQLRQAYGAQQGHLAEARDRARADLGSARTTRDQVMIALVTVFVLTVAALSLLLHRVVG
FT                   VPLTRLRTASDRVRSGAFGTRIEINGPSDVQAVARTVEDMRRRLADELSEAQSREALLA
FT                   EQTDELRRSNSELEQFAYVASHDLQEPLRKVASFCQLLEKRYGKELDDRGKQYIAFAVD
FT                   GAKRMQVLINDLLTFSRVGRVQEGWKPVDLDRSLDRALGNLAVAIEESGTVIERPESLP
FT                   ELLGDATALTMVWQNLVGNAVKFRREGVPCRISVTCVQEGEDWHLTVSDNGIGIAPEFA
FT                   DKVFVIFQRLHARDEYDGTGIGLALCRKIIEFHGGRIWLEPEPGEGTRFHFTLPVAPEA
FT                   PTHTAAELLAPALLTSQPGDPS"
     MTKQPAPGGF AARLSVQNWV HLILGGFIVV VCACLVIGGL VMARISDRTT ELVDRIQPAR        60
     SASFQLQNAL LDQETGIRGF ALTGDDSFLE PYEAGKAAEQ ERLAQVRRLV GSGGRYADDL       120
     DAIAAAAEQW RRSKAEPLIA TVREQGPSEA ATSARLQRSK ADFDQLRQAY GAQQGHLAEA       180
     RDRARADLGS ARTTRDQVMI ALVTVFVLTV AALSLLLHRV VGVPLTRLRT ASDRVRSGAF       240
     GTRIEINGPS DVQAVARTVE DMRRRLADEL SEAQSREALL AEQTDELRRS NSELEQFAYV       300
     ASHDLQEPLR KVASFCQLLE KRYGKELDDR GKQYIAFAVD GAKRMQVLIN DLLTFSRVGR       360
     VQEGWKPVDL DRSLDRALGN LAVAIEESGT VIERPESLPE LLGDATALTM VWQNLVGNAV       420
     KFRREGVPCR ISVTCVQEGE DWHLTVSDNG IGIAPEFADK VFVIFQRLHA RDEYDGTGIG       480
     LALCRKIIEF HGGRIWLEPE PGEGTRFHFT LPVAPEAPTH TAAELLAPAL LTSQPGDPS        539
//

If you have problems or comments...

PBIL Back to PBIL home page