(data stored in ACNUC7421 zone)

EMBL: AP009493.PE737

AP009493.PE737       Location/Qualifiers
FT   CDS             870686..871207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_737"
FT                   /product="putative regulatory protein containing a
FT                   conserved C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_737"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17566"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRZ8"
FT                   /protein_id="BAG17566.1"
FT                   /translation="MAEKVSDLTAAPWLEHMNEQVTSPPEDPGQGLAAAEVPPSAEVLM
FT                   SAEVFDGEPGCIAQARALADRFLTRLAVECLAPIGDHTRSDLMLAVSELVTNADRYSHG
FT                   PYLLELEGTAQLISVTVYDSSTAMPVLYAPDPSRLGGHGMEIVVALCDRLTAERVPVGK
FT                   RIRAEFQLSI"
     MAEKVSDLTA APWLEHMNEQ VTSPPEDPGQ GLAAAEVPPS AEVLMSAEVF DGEPGCIAQA        60
     RALADRFLTR LAVECLAPIG DHTRSDLMLA VSELVTNADR YSHGPYLLEL EGTAQLISVT       120
     VYDSSTAMPV LYAPDPSRLG GHGMEIVVAL CDRLTAERVP VGKRIRAEFQ LSI              173
//

If you have problems or comments...

PBIL Back to PBIL home page