(data stored in ACNUC7421 zone)

EMBL: AP009493.PE75

AP009493.PE75        Location/Qualifiers
FT   CDS             complement(78577..78792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_75t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_75t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16904"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM03"
FT                   /protein_id="BAG16904.1"
FT                   /translation="MSRPGSAEGGTCGRYAAMMDLVTLMLLSTAPVVLKVADALAQSLL
FT                   LRARAELARAQAAARGQDDQPAGGAQ"
     MSRPGSAEGG TCGRYAAMMD LVTLMLLSTA PVVLKVADAL AQSLLLRARA ELARAQAAAR        60
     GQDDQPAGGA Q                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page